Lineage for d3mfja_ (3mfj A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056847Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
    Uniprot P00760
  8. 2056849Domain d3mfja_: 3mfj A: [181073]
    automated match to d1aq7a_
    complexed with ben, ca, gol, so4

Details for d3mfja_

PDB Entry: 3mfj (more details), 0.8 Å

PDB Description: Bovine trypsin at 0.8 A resolution, restrained refinement
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3mfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mfja_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3mfja_:

Click to download the PDB-style file with coordinates for d3mfja_.
(The format of our PDB-style files is described here.)

Timeline for d3mfja_: