Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
Protein automated matches [190278] (5 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries) |
Domain d3mf3e_: 3mf3 E: [181041] automated match to d1i6ob_ complexed with act, co |
PDB Entry: 3mf3 (more details), 2.5 Å
SCOPe Domain Sequences for d3mf3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mf3e_ c.53.2.1 (E:) automated matches {Haemophilus influenzae [TaxId: 727]} dkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgelf vhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwll hirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvy dvndgflvdqgvmatsretleisyrnaiarlsild
Timeline for d3mf3e_: