Lineage for d3mf3d_ (3mf3 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883079Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2883111Protein automated matches [190278] (5 species)
    not a true protein
  7. 2883117Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries)
  8. 2883181Domain d3mf3d_: 3mf3 D: [181040]
    automated match to d1i6ob_
    complexed with act, co

Details for d3mf3d_

PDB Entry: 3mf3 (more details), 2.5 Å

PDB Description: cobalt(ii)-substituted haemophilus influenzae b-carbonic anhydrase
PDB Compounds: (D:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3mf3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mf3d_ c.53.2.1 (D:) automated matches {Haemophilus influenzae [TaxId: 727]}
dkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgelf
vhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwll
hirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvy
dvndgflvdqgvmatsretleisyrnaiarlsil

SCOPe Domain Coordinates for d3mf3d_:

Click to download the PDB-style file with coordinates for d3mf3d_.
(The format of our PDB-style files is described here.)

Timeline for d3mf3d_: