SCOP 1.71: Domain d5crxb1: 5crx B:19-129

Lineage for d5crxb1 (5crx B:19-129)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries)

8. Domain d5crxb1: 5crx B:19-129 [18104]
   Other proteins in same PDB: d5crxa2, d5crxb2
   mutant

Details for d5crxb1

PDB Entry: 5crx, 2.7 Å

PDB Description: asymmetric dna-bending in the cre-loxp site-specific recombination synapse

SCOP Domain Sequences for d5crxb1:

Sequence; same for both SEQRES and ATOM records:

>d5crxb1 a.60.9.1 (B:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d5crxb1:

• d5crxb1 first appeared (with stable ids) in SCOP 1.55
  
• d5crxb1 appears in SCOP 1.69
  
• d5crxb1 appears in SCOP 1.73
  
• d5crxb1 appears in the current release, SCOPe 2.08