Lineage for d3mezc_ (3mez C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806095Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 1806096Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 1806148Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 1806149Protein automated matches [190587] (7 species)
    not a true protein
  7. 1806155Species Crocus vernus [TaxId:87752] [189995] (1 PDB entry)
  8. 1806158Domain d3mezc_: 3mez C: [181035]
    automated match to d1jpca_
    complexed with fmt, gol

Details for d3mezc_

PDB Entry: 3mez (more details), 1.94 Å

PDB Description: x-ray structural analysis of a mannose specific lectin from dutch crocus (crocus vernus)
PDB Compounds: (C:) Mannose-specific lectin 3 chain 1

SCOPe Domain Sequences for d3mezc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mezc_ b.78.1.0 (C:) automated matches {Crocus vernus [TaxId: 87752]}
dnnvlltgdvihtdnqlsyesaafvmqgdcnlvlyneaggfqsnthgrgvdctlrlnnrg
qleihsansntpvwvyprsvntvrgnyaatlgpdqhvtiygpaiwstpaa

SCOPe Domain Coordinates for d3mezc_:

Click to download the PDB-style file with coordinates for d3mezc_.
(The format of our PDB-style files is described here.)

Timeline for d3mezc_: