Class b: All beta proteins [48724] (180 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
Protein automated matches [190587] (7 species) not a true protein |
Species Crocus vernus [TaxId:87752] [189995] (1 PDB entry) |
Domain d3mezc_: 3mez C: [181035] automated match to d1jpca_ complexed with fmt, gol |
PDB Entry: 3mez (more details), 1.94 Å
SCOPe Domain Sequences for d3mezc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mezc_ b.78.1.0 (C:) automated matches {Crocus vernus [TaxId: 87752]} dnnvlltgdvihtdnqlsyesaafvmqgdcnlvlyneaggfqsnthgrgvdctlrlnnrg qleihsansntpvwvyprsvntvrgnyaatlgpdqhvtiygpaiwstpaa
Timeline for d3mezc_: