SCOPe 2.08: Domain d3mexb_: 3mex B:

Lineage for d3mexb_ (3mex B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein MexR repressor [81686] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [81687] (3 PDB entries)

8. Domain d3mexb_: 3mex B: [181032]
   automated match to d1lnwa_

Details for d3mexb_

PDB Entry: 3mex, 2.1 Å

PDB Description: Crystal structure of MexR in oxidized state

PDB Compounds: (B:) Multidrug resistance operon repressor

SCOPe Domain Sequences for d3mexb_:

Sequence; same for both SEQRES and ATOM records:

>d3mexb_ a.4.5.28 (B:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
mnypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrq
mcrdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelf
apltpveqatlvhlldqslaaq

Timeline for d3mexb_:

• d3mexb_ first appeared in SCOPe 2.01
  
• d3mexb_ appears in SCOPe 2.07