Lineage for d3mexa_ (3mex A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906657Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 906661Protein MexR repressor [81686] (1 species)
  7. 906662Species Pseudomonas aeruginosa [TaxId:287] [81687] (3 PDB entries)
  8. 906665Domain d3mexa_: 3mex A: [181031]
    automated match to d1lnwa_

Details for d3mexa_

PDB Entry: 3mex (more details), 2.1 Å

PDB Description: Crystal structure of MexR in oxidized state
PDB Compounds: (A:) Multidrug resistance operon repressor

SCOPe Domain Sequences for d3mexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mexa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
mnypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrq
mcrdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelf
apltpveqatlvhlldqslaaq

SCOPe Domain Coordinates for d3mexa_:

Click to download the PDB-style file with coordinates for d3mexa_.
(The format of our PDB-style files is described here.)

Timeline for d3mexa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mexb_