SCOPe 2.06: Domain d3me2a_: 3me2 A:

Lineage for d3me2a_ (3me2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189134] (3 PDB entries)

8. Domain d3me2a_: 3me2 A: [181025]
   automated match to d1iqaa_
   complexed with cl, na

Details for d3me2a_

PDB Entry: 3me2, 2.8 Å

PDB Description: crystal structure of mouse rankl-rank complex

PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d3me2a_:

Sequence; same for both SEQRES and ATOM records:

>d3me2a_ b.22.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

Timeline for d3me2a_:

• d3me2a_ first appeared in SCOPe 2.01
  
• d3me2a_ appears in SCOPe 2.05
  
• d3me2a_ appears in SCOPe 2.07
  
• d3me2a_ appears in the current release, SCOPe 2.08