Lineage for d3me2a_ (3me2 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943163Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 943164Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 943165Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 943390Protein automated matches [190204] (2 species)
    not a true protein
  7. 943409Species Mouse (Mus musculus) [TaxId:10090] [189134] (2 PDB entries)
  8. 943410Domain d3me2a_: 3me2 A: [181025]
    automated match to d1iqaa_
    complexed with cl, na

Details for d3me2a_

PDB Entry: 3me2 (more details), 2.8 Å

PDB Description: crystal structure of mouse rankl-rank complex
PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d3me2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3me2a_ b.22.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOPe Domain Coordinates for d3me2a_:

Click to download the PDB-style file with coordinates for d3me2a_.
(The format of our PDB-style files is described here.)

Timeline for d3me2a_: