![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein automated matches [190204] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189134] (3 PDB entries) |
![]() | Domain d3me2a_: 3me2 A: [181025] automated match to d1iqaa_ complexed with cl, na |
PDB Entry: 3me2 (more details), 2.8 Å
SCOPe Domain Sequences for d3me2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3me2a_ b.22.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff klrageeisiqvsnpslldpdqdatyfgafkvqdid
Timeline for d3me2a_: