Lineage for d3mdyd_ (3mdy D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1899921Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1899932Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1899936Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 1899968Domain d3mdyd_: 3mdy D: [181024]
    Other proteins in same PDB: d3mdya_, d3mdyc_
    automated match to d1a7xa_
    complexed with ldn

Details for d3mdyd_

PDB Entry: 3mdy (more details), 2.05 Å

PDB Description: Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
PDB Compounds: (D:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d3mdyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdyd_ d.26.1.1 (D:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
smgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirg
weegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d3mdyd_:

Click to download the PDB-style file with coordinates for d3mdyd_.
(The format of our PDB-style files is described here.)

Timeline for d3mdyd_: