SCOPe 2.02: Domain d3mdyd_: 3mdy D:

Lineage for d3mdyd_ (3mdy D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (41 PDB entries)

8. Domain d3mdyd_: 3mdy D: [181024]
   Other proteins in same PDB: d3mdya_, d3mdyc_
   automated match to d1a7xa_
   complexed with ldn

Details for d3mdyd_

PDB Entry: 3mdy, 2.05 Å

PDB Description: Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189

PDB Compounds: (D:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d3mdyd_:

Sequence; same for both SEQRES and ATOM records:

>d3mdyd_ d.26.1.1 (D:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
smgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirg
weegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d3mdyd_:

• d3mdyd_ first appeared in SCOPe 2.01
  
• d3mdyd_ appears in SCOPe 2.03
  
• d3mdyd_ appears in the current release, SCOPe 2.08, called d3mdyd1