Lineage for d3mdyb1 (3mdy B:1-108)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548411Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 2548415Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 2548430Domain d3mdyb1: 3mdy B:1-108 [181022]
    Other proteins in same PDB: d3mdya_, d3mdyb2, d3mdyc_, d3mdyd2
    automated match to d1a7xa_
    complexed with ldn

Details for d3mdyb1

PDB Entry: 3mdy (more details), 2.05 Å

PDB Description: Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d3mdyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdyb1 d.26.1.1 (B:1-108) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw
eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d3mdyb1:

Click to download the PDB-style file with coordinates for d3mdyb1.
(The format of our PDB-style files is described here.)

Timeline for d3mdyb1: