Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) cis-trans prolyl-isomerase |
Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries) |
Domain d3mdyb1: 3mdy B:1-108 [181022] Other proteins in same PDB: d3mdya_, d3mdyb2, d3mdyc_, d3mdyd2 automated match to d1a7xa_ complexed with ldn |
PDB Entry: 3mdy (more details), 2.05 Å
SCOPe Domain Sequences for d3mdyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdyb1 d.26.1.1 (B:1-108) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d3mdyb1:
View in 3D Domains from other chains: (mouse over for more information) d3mdya_, d3mdyc_, d3mdyd1, d3mdyd2 |