Lineage for d3mdyb_ (3mdy B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1899921Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1899932Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1899936Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 1899967Domain d3mdyb_: 3mdy B: [181022]
    Other proteins in same PDB: d3mdya_, d3mdyc_
    automated match to d1a7xa_
    complexed with ldn

Details for d3mdyb_

PDB Entry: 3mdy (more details), 2.05 Å

PDB Description: Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d3mdyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdyb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
smgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirg
weegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d3mdyb_:

Click to download the PDB-style file with coordinates for d3mdyb_.
(The format of our PDB-style files is described here.)

Timeline for d3mdyb_: