SCOPe 2.01: Domain d3mdfb_: 3mdf B:

Lineage for d3mdfb_ (3mdf B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries)

8. Domain d3mdfb_: 3mdf B: [181020]
   automated match to d2cqba1

Details for d3mdfb_

PDB Entry: 3mdf, 1.85 Å

PDB Description: Crystal structure of the RRM domain of Cyclophilin 33

PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d3mdfb_:

Sequence; same for both SEQRES and ATOM records:

>d3mdfb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
aaaidnmneselfgrtirvnlak

Timeline for d3mdfb_:

• d3mdfb_ is new in SCOPe 2.01-stable
  
• d3mdfb_ appears in SCOPe 2.02
  
• d3mdfb_ appears in the current release, SCOPe 2.08