SCOP 1.57: Domain d3crxb1: 3crx B:19-129

Lineage for d3crxb1 (3crx B:19-129)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.60: SAM domain-like [47768] (10 superfamilies)

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (5 PDB entries)

8. Domain d3crxb1: 3crx B:19-129 [18102]
   Other proteins in same PDB: d3crxa2, d3crxb2

Details for d3crxb1

PDB Entry: 3crx, 2.5 Å

PDB Description: cre recombinase/dna complex intermediate i

SCOP Domain Sequences for d3crxb1:

Sequence; same for both SEQRES and ATOM records:

>d3crxb1 a.60.9.1 (B:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d3crxb1:

• d3crxb1 first appeared (with stable ids) in SCOP 1.55
  
• d3crxb1 appears in SCOP 1.59
  
• d3crxb1 appears in the current release, SCOPe 2.08