![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
![]() | Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) ![]() superficially similar to membrane translocation domains |
![]() | Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
![]() | Protein automated matches [190930] (2 species) not a true protein |
![]() | Species Influenza A virus [TaxId:641501] [189320] (1 PDB entry) |
![]() | Domain d3md2d_: 3md2 D: [181018] automated match to d1aa7b_ |
PDB Entry: 3md2 (more details), 2.2 Å
SCOPe Domain Sequences for d3md2d_:
Sequence, based on SEQRES records: (download)
>d3md2d_ a.95.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]} ltevetyvlsiipsgplkaeiaqrlesvfagkntdlealmewlktrpilspltkgilgfv ftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevslsystga lascmgliynrmgtvtteaafglvcatceqiads
>d3md2d_ a.95.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]} ltevetyvlsiipsgplkaeiaqrlesvfagkntdlealmewlktrpilspltkgilgfv ftltrrfvqnalndpnnmdravklykklkreitfhgakevslsystgalascmgliynrm gtvtteaafglvcatceqiads
Timeline for d3md2d_: