SCOPe 2.08: Domain d3md2d_: 3md2 D:

Lineage for d3md2d_ (3md2 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [189320] (1 PDB entry)

8. Domain d3md2d_: 3md2 D: [181018]
   automated match to d1aa7b_

Details for d3md2d_

PDB Entry: 3md2, 2.2 Å

PDB Description: Crystal structure of the matrix protein 1 from influenza A virus (A/California/04/2009 (H1N1))

PDB Compounds: (D:) matrix protein 1

SCOPe Domain Sequences for d3md2d_:

Sequence, based on SEQRES records:

>d3md2d_ a.95.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]}
ltevetyvlsiipsgplkaeiaqrlesvfagkntdlealmewlktrpilspltkgilgfv
ftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevslsystga
lascmgliynrmgtvtteaafglvcatceqiads

Sequence, based on observed residues (ATOM records):

>d3md2d_ a.95.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]}
ltevetyvlsiipsgplkaeiaqrlesvfagkntdlealmewlktrpilspltkgilgfv
ftltrrfvqnalndpnnmdravklykklkreitfhgakevslsystgalascmgliynrm
gtvtteaafglvcatceqiads

Timeline for d3md2d_:

• d3md2d_ first appeared in SCOPe 2.01
  
• d3md2d_ appears in SCOPe 2.07