Lineage for d3md2a_ (3md2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720943Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
    multihelical; consists of two different all-alpha subdomains, 4 helices each
  4. 2720944Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
    superficially similar to membrane translocation domains
    automatically mapped to Pfam PF00598
  5. 2720945Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)
  6. 2720952Protein automated matches [190930] (4 species)
    not a true protein
  7. 2720969Species Influenza A virus [TaxId:641501] [189320] (1 PDB entry)
  8. 2720970Domain d3md2a_: 3md2 A: [181015]
    automated match to d1aa7b_

Details for d3md2a_

PDB Entry: 3md2 (more details), 2.2 Å

PDB Description: Crystal structure of the matrix protein 1 from influenza A virus (A/California/04/2009 (H1N1))
PDB Compounds: (A:) matrix protein 1

SCOPe Domain Sequences for d3md2a_:

Sequence, based on SEQRES records: (download)

>d3md2a_ a.95.1.1 (A:) automated matches {Influenza A virus [TaxId: 641501]}
ltevetyvlsiipsgplkaeiaqrlesvfagkntdlealmewlktrpilspltkgilgfv
ftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevslsystga
lascmgliynrmgtvtteaafglvcatceqiads

Sequence, based on observed residues (ATOM records): (download)

>d3md2a_ a.95.1.1 (A:) automated matches {Influenza A virus [TaxId: 641501]}
ltevetyvlsiipsgplkaeiaqrlesvfagkntdlealmewlktrpilspltkgilgfv
ftltrrfvqnalndpnnmdravklykklkreitfhgakevslsystgalascmgliynrm
gtvtteaafglvcatceqiads

SCOPe Domain Coordinates for d3md2a_:

Click to download the PDB-style file with coordinates for d3md2a_.
(The format of our PDB-style files is described here.)

Timeline for d3md2a_: