![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries) |
![]() | Domain d3md1b_: 3md1 B: [181014] Other proteins in same PDB: d3md1a2 automated match to d1x5sa1 complexed with gol |
PDB Entry: 3md1 (more details), 1.6 Å
SCOPe Domain Sequences for d3md1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3md1b_ d.58.7.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam dsmqgqdlngrplrinwaa
Timeline for d3md1b_: