Lineage for d3md1a_ (3md1 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205320Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1205796Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1205797Protein automated matches [190896] (2 species)
    not a true protein
  7. 1205798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (1 PDB entry)
  8. 1205799Domain d3md1a_: 3md1 A: [181013]
    automated match to d1x5sa1
    complexed with gol

Details for d3md1a_

PDB Entry: 3md1 (more details), 1.6 Å

PDB Description: Crystal Structure of the Second RRM Domain of Yeast Poly(U)-Binding Protein (Pub1)
PDB Compounds: (A:) Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1

SCOPe Domain Sequences for d3md1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3md1a_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam
dsmqgqdlngrplrinwaakleh

SCOPe Domain Coordinates for d3md1a_:

Click to download the PDB-style file with coordinates for d3md1a_.
(The format of our PDB-style files is described here.)

Timeline for d3md1a_: