SCOPe 2.07: Domain d3mcjb_: 3mcj B:

Lineage for d3mcjb_ (3mcj B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 protein domains)

6. Protein automated matches [190868] (2 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188216] (3 PDB entries)

8. Domain d3mcjb_: 3mcj B: [181008]
   automated match to d2f7wa1
   complexed with edo

Details for d3mcjb_

PDB Entry: 3mcj, 1.9 Å

PDB Description: Crystal structure of molybdenum cofactor biosynthesis (AQ_061) other form from aquifex aeolicus VF5

PDB Compounds: (B:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d3mcjb_:

Sequence; same for both SEQRES and ATOM records:

>d3mcjb_ c.57.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektlie
ladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqt
agirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk

Timeline for d3mcjb_:

• d3mcjb_ first appeared in SCOPe 2.01
  
• d3mcjb_ appears in SCOPe 2.06