Lineage for d3mcib_ (3mci B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890091Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2890163Protein automated matches [190868] (2 species)
    not a true protein
  7. 2890164Species Aquifex aeolicus [TaxId:224324] [188216] (3 PDB entries)
  8. 2890166Domain d3mcib_: 3mci B: [181005]
    automated match to d2f7wa1
    complexed with edo, peg

Details for d3mcib_

PDB Entry: 3mci (more details), 1.7 Å

PDB Description: Crystal structure of molybdenum cofactor biosynthesis (AQ_061) from aquifex aeolicus VF5
PDB Compounds: (B:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d3mcib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcib_ c.57.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektlie
ladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqt
agirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpk

SCOPe Domain Coordinates for d3mcib_:

Click to download the PDB-style file with coordinates for d3mcib_.
(The format of our PDB-style files is described here.)

Timeline for d3mcib_: