Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.1: MogA-like [53219] (6 proteins) |
Protein automated matches [190868] (2 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188216] (3 PDB entries) |
Domain d3mcib_: 3mci B: [181005] automated match to d2f7wa1 complexed with edo, peg |
PDB Entry: 3mci (more details), 1.7 Å
SCOPe Domain Sequences for d3mcib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcib_ c.57.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]} ekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektlie ladekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqt agirgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpk
Timeline for d3mcib_: