Lineage for d3mc1a1 (3mc1 A:2-215)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167647Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2167648Protein automated matches [190447] (51 species)
    not a true protein
  7. 2167758Species Clostridium acetobutylicum [TaxId:1488] [189302] (1 PDB entry)
  8. 2167759Domain d3mc1a1: 3mc1 A:2-215 [181001]
    Other proteins in same PDB: d3mc1a2
    automated match to d2ah5a1
    complexed with cl, gol, na

Details for d3mc1a1

PDB Entry: 3mc1 (more details), 1.93 Å

PDB Description: crystal structure of a predicted phosphatase from clostridium acetobutylicum
PDB Compounds: (A:) Predicted phosphatase, HAD family

SCOPe Domain Sequences for d3mc1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mc1a1 c.108.1.0 (A:2-215) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
ynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyynfde
etatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqilehf
klafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnlpsi
gvtygfgsyeelknaganyivnsvdelhkkilel

SCOPe Domain Coordinates for d3mc1a1:

Click to download the PDB-style file with coordinates for d3mc1a1.
(The format of our PDB-style files is described here.)

Timeline for d3mc1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mc1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3mc1b_