Lineage for d3mc1a_ (3mc1 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1188163Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1188164Protein automated matches [190447] (25 species)
    not a true protein
  7. 1188187Species Clostridium acetobutylicum [TaxId:1488] [189302] (1 PDB entry)
  8. 1188188Domain d3mc1a_: 3mc1 A: [181001]
    automated match to d2ah5a1
    complexed with cl, gol, na

Details for d3mc1a_

PDB Entry: 3mc1 (more details), 1.93 Å

PDB Description: crystal structure of a predicted phosphatase from clostridium acetobutylicum
PDB Compounds: (A:) Predicted phosphatase, HAD family

SCOPe Domain Sequences for d3mc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mc1a_ c.108.1.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
slynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyynf
deetatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqile
hfklafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnlp
sigvtygfgsyeelknaganyivnsvdelhkkilel

SCOPe Domain Coordinates for d3mc1a_:

Click to download the PDB-style file with coordinates for d3mc1a_.
(The format of our PDB-style files is described here.)

Timeline for d3mc1a_: