Lineage for d2crxb1 (2crx B:19-129)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48869Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 48870Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 48871Protein Cre recombinase [47825] (1 species)
  7. 48872Species Bacteriophage P1 [TaxId:10678] [47826] (5 PDB entries)
  8. 48878Domain d2crxb1: 2crx B:19-129 [18100]
    Other proteins in same PDB: d2crxa2, d2crxb2

Details for d2crxb1

PDB Entry: 2crx (more details), 2.5 Å

PDB Description: structure of the holliday junction intermediate in cre-loxp site-specific recombination

SCOP Domain Sequences for d2crxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crxb1 a.60.9.1 (B:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d2crxb1:

Click to download the PDB-style file with coordinates for d2crxb1.
(The format of our PDB-style files is described here.)

Timeline for d2crxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2crxb2