SCOPe 2.08: Domain d3mbva_: 3mbv A:

Lineage for d3mbva_ (3mbv A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein automated matches [190122] (8 species)
   not a true protein

7. Species Halobacterium salinarum [TaxId:2242] [186845] (18 PDB entries)

8. Domain d3mbva_: 3mbv A: [180998]
   automated match to d1cwqa_
   complexed with bxc, ret

Details for d3mbva_

PDB Entry: 3mbv, 2 Å

PDB Description: Structure of bacterirhodopsin crystallized in betta-XylOC(16+4) meso phase

PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d3mbva_:

Sequence, based on SEQRES records:

>d3mbva_ f.13.1.1 (A:) automated matches {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Sequence, based on observed residues (ATOM records):

>d3mbva_ f.13.1.1 (A:) automated matches {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
ligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d3mbva_:

• d3mbva_ first appeared in SCOPe 2.01
  
• d3mbva_ appears in SCOPe 2.07