Lineage for d3mbcb_ (3mbc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138891Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 protein domains)
    the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion
    automatically mapped to Pfam PF03971
  6. 2138898Protein automated matches [190493] (4 species)
    not a true protein
  7. 2138901Species Corynebacterium glutamicum [TaxId:196627] [189781] (1 PDB entry)
  8. 2138903Domain d3mbcb_: 3mbc B: [180996]
    automated match to d1itwa_
    complexed with mg, nap

Details for d3mbcb_

PDB Entry: 3mbc (more details), 1.9 Å

PDB Description: Crystal structure of monomeric isocitrate dehydrogenase from Corynebacterium glutamicum in complex with NADP
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d3mbcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbcb_ c.77.1.2 (B:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
akiiwtrtdeapllatyslkpvveafaatagievetrdislagrilaqfperltedqkvg
nalaelgelaktpeaniiklpnisasvpqlkaaikelqdqgydipelpdnattdeekdil
arynavkgsavnpvlregnsdrrapiavknfvkkfphrmgewsadsktnvatmdandfrh
neksiildaadevqikhiaadgtetilkdslkllegevldgtvlsakaldaflleqvara
kaegilfsahlkatmmkvsdpiifghvvrayfadvfaqygeqllaaglngenglaailsg
lesldngeeikaafekgledgpdlamvnsargitnlhvpsdvivdasmpamirtsghmwn
kddqeqdtlaiipdssyagvyqtviedcrkngafdpttmgtvpnvglmaqkaeeygshdk
tfrieadgvvqvvssngdvliehdveandiwracqvkdapiqdwvklavtrsrlsgmpav
fwldperahdrnlaslvekyladhdtegldiqilspveatqlsidrirrgedtisvtgnv
lrdyntdlfpilelgtsakmlsvvplmaggglfetgaggsapkhvqqvqeenhlrwdslg
eflalaesfrhelnnngntkagvladaldkatekllneekspsrkvgeidnrgshfwltk
fwadelaaqtedadlaatfapvaealntgaadidaallavqggatdlggyyspneekltn
imrpvaqfneivdal

SCOPe Domain Coordinates for d3mbcb_:

Click to download the PDB-style file with coordinates for d3mbcb_.
(The format of our PDB-style files is described here.)

Timeline for d3mbcb_: