| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
| Protein Osmoprotection protein ProX [110750] (1 species) functionally related to the bacterial ProX |
| Species Archaeoglobus fulgidus [TaxId:2234] [110751] (5 PDB entries) Uniprot O29280 # AF0982 |
| Domain d3mama_: 3mam A: [180989] automated match to d1sw1a_ complexed with bet, edo, epe |
PDB Entry: 3mam (more details), 1.8 Å
SCOPe Domain Sequences for d3mama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mama_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddaalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk
Timeline for d3mama_: