Lineage for d3mama_ (3mam A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009217Protein Osmoprotection protein ProX [110750] (1 species)
    functionally related to the bacterial ProX
  7. 1009218Species Archaeoglobus fulgidus [TaxId:2234] [110751] (5 PDB entries)
    Uniprot O29280 # AF0982
  8. 1009223Domain d3mama_: 3mam A: [180989]
    automated match to d1sw1a_
    complexed with bet, edo, epe

Details for d3mama_

PDB Entry: 3mam (more details), 1.8 Å

PDB Description: a molecular switch changes the low to the high affinity state in the substrate binding protein afprox
PDB Compounds: (A:) osmoprotection protein (proX)

SCOPe Domain Sequences for d3mama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mama_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddaalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

SCOPe Domain Coordinates for d3mama_:

Click to download the PDB-style file with coordinates for d3mama_.
(The format of our PDB-style files is described here.)

Timeline for d3mama_: