SCOPe 2.05: Domain d3mala_: 3mal A:

Lineage for d3mala_ (3mal A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.6: MIR domain [82109] (3 families)

5. Family b.42.6.0: automated matches [191626] (1 protein)
   not a true family

6. Protein automated matches [191149] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189301] (1 PDB entry)

8. Domain d3mala_: 3mal A: [180987]
   automated match to d1t9fa_
   complexed with edo, so4

Details for d3mala_

PDB Entry: 3mal, 1.95 Å

PDB Description: Crystal structure of the SDF2-like protein from Arabidopsis thaliana

PDB Compounds: (A:) Stromal cell-derived factor 2-like protein

SCOPe Domain Sequences for d3mala_:

Sequence; same for both SEQRES and ATOM records:

>d3mala_ b.42.6.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
veitygsaiklmhektkfrlhshdvpygsgsgqqsvtgfpgvvdsnsywivkpvpgttek
qgdavksgatirlqhmktrkwlhshlhaspisgnlevscfgddtnsdtgdhwkliiegsg
ktwkqdqrvrlqhidtsgylhshdkkyqriaggqqevcgirekkadniwlaaegvylpln
e

Timeline for d3mala_:

• d3mala_ first appeared in SCOPe 2.01
  
• d3mala_ appears in SCOPe 2.04
  
• d3mala_ appears in SCOPe 2.06
  
• d3mala_ appears in the current release, SCOPe 2.08