Lineage for d3ma2b_ (3ma2 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788641Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 1788642Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 1788643Protein TIMP-1 [50244] (1 species)
  7. 1788644Species Human (Homo sapiens) [TaxId:9606] [50245] (6 PDB entries)
  8. 1788646Domain d3ma2b_: 3ma2 B: [180982]
    Other proteins in same PDB: d3ma2a_, d3ma2d_
    automated match to d1d2ba_
    complexed with ca, zn

Details for d3ma2b_

PDB Entry: 3ma2 (more details), 2.05 Å

PDB Description: complex membrane type-1 matrix metalloproteinase (mt1-mmp) with tissue inhibitor of metalloproteinase-1 (timp-1)
PDB Compounds: (B:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d3ma2b_:

Sequence, based on SEQRES records: (download)

>d3ma2b_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcapvhpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhitlcsfvapwnslslaqrrgftkty
tvgc

Sequence, based on observed residues (ATOM records): (download)

>d3ma2b_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcapvhpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfdirfvytpame
svcgyfhrshnrseefliagklqdgllhitlcsfvapwnslslaqrrgftktytvgc

SCOPe Domain Coordinates for d3ma2b_:

Click to download the PDB-style file with coordinates for d3ma2b_.
(The format of our PDB-style files is described here.)

Timeline for d3ma2b_: