Lineage for d3m9yb_ (3m9y B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968240Species Staphylococcus aureus [TaxId:282458] [189897] (1 PDB entry)
  8. 968242Domain d3m9yb_: 3m9y B: [180979]
    automated match to d2btma_
    complexed with cit, na

Details for d3m9yb_

PDB Entry: 3m9y (more details), 1.9 Å

PDB Description: Crystal structure of Triosephosphate isomerase from methicillin resistant Staphylococcus aureus at 1.9 Angstrom resolution
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3m9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m9yb_ c.1.1.1 (B:) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]}
smrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaq
gleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaif
khgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgks
stsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggas
lkvedfvqllegak

SCOPe Domain Coordinates for d3m9yb_:

Click to download the PDB-style file with coordinates for d3m9yb_.
(The format of our PDB-style files is described here.)

Timeline for d3m9yb_: