| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thioredoxin [52835] (16 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries) |
| Domain d3m9jb_: 3m9j B: [180973] automated match to d1erva_ mutant |
PDB Entry: 3m9j (more details), 1.1 Å
SCOPe Domain Sequences for d3m9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m9jb_ c.47.1.1 (B:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasesevksmptfqffkkgqkvgefsgankekleatinelv
Timeline for d3m9jb_: