Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) |
Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
Protein Cre recombinase [47825] (1 species) |
Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries) Uniprot P06956 20-341 |
Domain d1crxa1: 1crx A:20-129 [18097] Other proteins in same PDB: d1crxa2, d1crxb2 protein/DNA complex; complexed with po4 |
PDB Entry: 1crx (more details), 2.4 Å
SCOPe Domain Sequences for d1crxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crxa1 a.60.9.1 (A:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1crxa1: