Lineage for d3m95a_ (3m95 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932851Species Silkworm (Bombyx mori) [TaxId:7091] [189398] (1 PDB entry)
  8. 2932852Domain d3m95a_: 3m95 A: [180966]
    Other proteins in same PDB: d3m95b2
    automated match to d1kota_

Details for d3m95a_

PDB Entry: 3m95 (more details), 2.4 Å

PDB Description: Crystal structure of autophagy-related protein Atg8 from the silkworm Bombyx mori
PDB Compounds: (A:) Autophagy related protein Atg8

SCOPe Domain Sequences for d3m95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m95a_ d.15.1.3 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mkfqykeehsfekrkaegekirrkypdrvpvivekapkarlgdldkkkylvpsdltvgqf
yflirkrihlrpedalfffvnnvipptsatmgslyqehhdedfflyiafsdenvy

SCOPe Domain Coordinates for d3m95a_:

Click to download the PDB-style file with coordinates for d3m95a_.
(The format of our PDB-style files is described here.)

Timeline for d3m95a_: