| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
| Protein automated matches [190358] (6 species) not a true protein |
| Species Silkworm (Bombyx mori) [TaxId:7091] [189398] (1 PDB entry) |
| Domain d3m95a_: 3m95 A: [180966] Other proteins in same PDB: d3m95b2 automated match to d1kota_ |
PDB Entry: 3m95 (more details), 2.4 Å
SCOPe Domain Sequences for d3m95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m95a_ d.15.1.3 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mkfqykeehsfekrkaegekirrkypdrvpvivekapkarlgdldkkkylvpsdltvgqf
yflirkrihlrpedalfffvnnvipptsatmgslyqehhdedfflyiafsdenvy
Timeline for d3m95a_: