SCOPe 2.01: Domain d3m8ma_: 3m8m A:

Lineage for d3m8ma_ (3m8m A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (4 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186892] (6 PDB entries)

8. Domain d3m8ma_: 3m8m A: [180961]
   automated match to d1mn1a_
   complexed with ca, gol, hem, man

Details for d3m8ma_

PDB Entry: 3m8m, 1.05 Å

PDB Description: 1.05 a structure of manganese-free manganese peroxidase

PDB Compounds: (A:) Manganese peroxidase 1

SCOPe Domain Sequences for d3m8ma_:

Sequence; same for both SEQRES and ATOM records:

>d3m8ma_ a.93.1.1 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa

Timeline for d3m8ma_:

• d3m8ma_ is new in SCOPe 2.01-stable
  
• d3m8ma_ appears in SCOPe 2.02
  
• d3m8ma_ appears in the current release, SCOPe 2.08