Lineage for d3m8ma_ (3m8m A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720340Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186892] (6 PDB entries)
  8. 2720342Domain d3m8ma_: 3m8m A: [180961]
    automated match to d1mn1a_
    complexed with ca, gol, hem, man

Details for d3m8ma_

PDB Entry: 3m8m (more details), 1.05 Å

PDB Description: 1.05 a structure of manganese-free manganese peroxidase
PDB Compounds: (A:) Manganese peroxidase 1

SCOPe Domain Sequences for d3m8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8ma_ a.93.1.1 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa

SCOPe Domain Coordinates for d3m8ma_:

Click to download the PDB-style file with coordinates for d3m8ma_.
(The format of our PDB-style files is described here.)

Timeline for d3m8ma_: