Lineage for d3m8ak_ (3m8a K:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725389Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 1725398Protein automated matches [190929] (6 species)
    not a true protein
  7. 1725412Species Influenza A virus [TaxId:641809] [189318] (1 PDB entry)
  8. 1725423Domain d3m8ak_: 3m8a K: [180955]
    automated match to d1ns1a_
    complexed with act, mli, na

Details for d3m8ak_

PDB Entry: 3m8a (more details), 2.1 Å

PDB Description: Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009
PDB Compounds: (K:) nonstructural protein 1

SCOPe Domain Sequences for d3m8ak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8ak_ a.16.1.1 (K:) automated matches {Influenza A virus [TaxId: 641809]}
mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
gkqivewilk

SCOPe Domain Coordinates for d3m8ak_:

Click to download the PDB-style file with coordinates for d3m8ak_.
(The format of our PDB-style files is described here.)

Timeline for d3m8ak_: