| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein automated matches [190929] (6 species) not a true protein |
| Species Influenza A virus [TaxId:641809] [189318] (1 PDB entry) |
| Domain d3m8ae_: 3m8a E: [180949] Other proteins in same PDB: d3m8ac2, d3m8ag2, d3m8aj2, d3m8al2 automated match to d1ns1a_ complexed with act, mli, na |
PDB Entry: 3m8a (more details), 2.1 Å
SCOPe Domain Sequences for d3m8ae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m8ae_ a.16.1.1 (E:) automated matches {Influenza A virus [TaxId: 641809]}
mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
gkqivewilkee
Timeline for d3m8ae_: