Class a: All alpha proteins [46456] (286 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein automated matches [190929] (6 species) not a true protein |
Species Influenza A virus [TaxId:641809] [189318] (1 PDB entry) |
Domain d3m8ae_: 3m8a E: [180949] automated match to d1ns1a_ complexed with act, mli, na |
PDB Entry: 3m8a (more details), 2.1 Å
SCOPe Domain Sequences for d3m8ae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m8ae_ a.16.1.1 (E:) automated matches {Influenza A virus [TaxId: 641809]} mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv gkqivewilkee
Timeline for d3m8ae_: