SCOPe 2.07: Domain d3m8ac1: 3m8a C:1-72

Lineage for d3m8ac1 (3m8a C:1-72)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (8 species)
   not a true protein

7. Species Influenza A virus (a/california/07/2009(h1n1)) [TaxId:641809] [189318] (1 PDB entry)

8. Domain d3m8ac1: 3m8a C:1-72 [180947]
   Other proteins in same PDB: d3m8ac2, d3m8ag2, d3m8aj2, d3m8al2
   automated match to d1ns1a_
   complexed with act, mli, na

Details for d3m8ac1

PDB Entry: 3m8a, 2.1 Å

PDB Description: Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009

PDB Compounds: (C:) nonstructural protein 1

SCOPe Domain Sequences for d3m8ac1:

Sequence; same for both SEQRES and ATOM records:

>d3m8ac1 a.16.1.1 (C:1-72) automated matches {Influenza A virus (a/california/07/2009(h1n1)) [TaxId: 641809]}
mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
gkqivewilkee

Timeline for d3m8ac1:

• d3m8ac1 first appeared in SCOPe 2.01, called d3m8ac_
  
• d3m8ac1 appears in SCOPe 2.06
  
• d3m8ac1 appears in the current release, SCOPe 2.08