Lineage for d3m8aa_ (3m8a A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311100Protein automated matches [190929] (8 species)
    not a true protein
  7. 2311104Species Influenza A virus (a/california/07/2009(h1n1)) [TaxId:641809] [189318] (1 PDB entry)
  8. 2311105Domain d3m8aa_: 3m8a A: [180945]
    Other proteins in same PDB: d3m8ac2, d3m8ag2, d3m8aj2, d3m8al2
    automated match to d1ns1a_
    complexed with act, mli, na

Details for d3m8aa_

PDB Entry: 3m8a (more details), 2.1 Å

PDB Description: Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009
PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d3m8aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8aa_ a.16.1.1 (A:) automated matches {Influenza A virus (a/california/07/2009(h1n1)) [TaxId: 641809]}
mdsntmssfqvdcflwhirkrfadnglgdapfldrlrrdqkslkgrgntlgldietatlv
gkqivewilke

SCOPe Domain Coordinates for d3m8aa_:

Click to download the PDB-style file with coordinates for d3m8aa_.
(The format of our PDB-style files is described here.)

Timeline for d3m8aa_: