SCOPe 2.08: Domain d3m83e1: 3m83 E:1-323

Lineage for d3m83e1 (3m83 E:1-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
   Pfam PF05448; AXE1

6. Protein automated matches [191114] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [189317] (3 PDB entries)

8. Domain d3m83e1: 3m83 E:1-323 [180943]
   Other proteins in same PDB: d3m83a2, d3m83b2, d3m83c2, d3m83d2, d3m83e2, d3m83f2
   automated match to d1vlqa_
   complexed with act, ca, edo

Details for d3m83e1

PDB Entry: 3m83, 2.12 Å

PDB Description: crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.12 a resolution (paraoxon inhibitor complex structure)

PDB Compounds: (E:) acetyl xylan esterase

SCOPe Domain Sequences for d3m83e1:

Sequence; same for both SEQRES and ATOM records:

>d3m83e1 c.69.1.25 (E:1-323) automated matches {Thermotoga maritima [TaxId: 2336]}
maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt
fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq
gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthr
dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
nnhegggsfqaveqvkflkklfe

Timeline for d3m83e1:

• d3m83e1 first appeared in SCOPe 2.01, called d3m83e_
  
• d3m83e1 appears in SCOPe 2.07