Lineage for d1d8ba_ (1d8b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329380Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2329381Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins)
  6. 2329382Protein HRDC domain from RecQ helicase [47821] (2 species)
  7. 2329383Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47822] (1 PDB entry)
  8. 2329384Domain d1d8ba_: 1d8b A: [18094]

Details for d1d8ba_

PDB Entry: 1d8b (more details)

PDB Description: nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase
PDB Compounds: (A:) sgs1 recq helicase

SCOPe Domain Sequences for d1d8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ba_ a.60.8.1 (A:) HRDC domain from RecQ helicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elnnlrmtyerlrelslnlgnrmvppvgnfmpdsilkkmaailpmndsafatlgtvedky
rrrfkyfkatiadlskkrsse

SCOPe Domain Coordinates for d1d8ba_:

Click to download the PDB-style file with coordinates for d1d8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ba_: