Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (5 families) |
Family a.60.8.1: HRDC domain from helicases [47820] (3 proteins) |
Protein HRDC domain from RecQ helicase [47821] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47822] (1 PDB entry) |
Domain d1d8ba_: 1d8b A: [18094] |
PDB Entry: 1d8b (more details)
SCOPe Domain Sequences for d1d8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8ba_ a.60.8.1 (A:) HRDC domain from RecQ helicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elnnlrmtyerlrelslnlgnrmvppvgnfmpdsilkkmaailpmndsafatlgtvedky rrrfkyfkatiadlskkrsse
Timeline for d1d8ba_: