Lineage for d1d8ba_ (1d8b A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4477Superfamily a.60.8: HRDC domain from RecQ helicase [47819] (1 family) (S)
  5. 4478Family a.60.8.1: HRDC domain from RecQ helicase [47820] (1 protein)
  6. 4479Protein HRDC domain from RecQ helicase [47821] (1 species)
  7. 4480Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47822] (1 PDB entry)
  8. 4481Domain d1d8ba_: 1d8b A: [18094]

Details for d1d8ba_

PDB Entry: 1d8b (more details)

PDB Description: nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase

SCOP Domain Sequences for d1d8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ba_ a.60.8.1 (A:) HRDC domain from RecQ helicase {Baker's yeast (Saccharomyces cerevisiae)}
elnnlrmtyerlrelslnlgnrmvppvgnfmpdsilkkmaailpmndsafatlgtvedky
rrrfkyfkatiadlskkrsse

SCOP Domain Coordinates for d1d8ba_:

Click to download the PDB-style file with coordinates for d1d8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ba_: