Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) |
Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species) |
Species Pyrococcus furiosus [TaxId:2261] [47818] (1 PDB entry) |
Domain d1b43b1: 1b43 B:220-339 [18093] Other proteins in same PDB: d1b43a2, d1b43b2 |
PDB Entry: 1b43 (more details), 2 Å
SCOPe Domain Sequences for d1b43b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b43b1 a.60.7.1 (B:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus furiosus [TaxId: 2261]} ltreklielailvgtdynpggikgiglkkaleivrhskdplakfqkqsdvdlyaikeffl nppvtdnynlvwrdpdeegilkflcdehdfseervknglerlkkaiksgkqstleswfkr
Timeline for d1b43b1: