SCOP 1.59: Domain d1b43b1: 1b43 B:220-339

Lineage for d1b43b1 (1b43 B:220-339)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.60: SAM domain-like [47768] (11 superfamilies)

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins)

6. Protein Fen-1 nuclease [47817] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [47818] (1 PDB entry)

8. Domain d1b43b1: 1b43 B:220-339 [18093]
   Other proteins in same PDB: d1b43a2, d1b43b2

Details for d1b43b1

PDB Entry: 1b43, 2 Å

PDB Description: fen-1 from p. furiosus

SCOP Domain Sequences for d1b43b1:

Sequence; same for both SEQRES and ATOM records:

>d1b43b1 a.60.7.1 (B:220-339) Fen-1 nuclease {Archaeon Pyrococcus furiosus}
ltreklielailvgtdynpggikgiglkkaleivrhskdplakfqkqsdvdlyaikeffl
nppvtdnynlvwrdpdeegilkflcdehdfseervknglerlkkaiksgkqstleswfkr

Timeline for d1b43b1:

• d1b43b1 first appeared (with stable ids) in SCOP 1.55
  
• d1b43b1 appears in SCOP 1.57
  
• d1b43b1 appears in SCOP 1.61
  
• d1b43b1 appears in the current release, SCOPe 2.08