Lineage for d1b43b1 (1b43 B:220-339)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716189Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2716190Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2716197Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species)
  7. 2716209Species Pyrococcus furiosus [TaxId:2261] [47818] (1 PDB entry)
  8. 2716211Domain d1b43b1: 1b43 B:220-339 [18093]
    Other proteins in same PDB: d1b43a2, d1b43b2

Details for d1b43b1

PDB Entry: 1b43 (more details), 2 Å

PDB Description: fen-1 from p. furiosus
PDB Compounds: (B:) protein (fen-1)

SCOPe Domain Sequences for d1b43b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b43b1 a.60.7.1 (B:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus furiosus [TaxId: 2261]}
ltreklielailvgtdynpggikgiglkkaleivrhskdplakfqkqsdvdlyaikeffl
nppvtdnynlvwrdpdeegilkflcdehdfseervknglerlkkaiksgkqstleswfkr

SCOPe Domain Coordinates for d1b43b1:

Click to download the PDB-style file with coordinates for d1b43b1.
(The format of our PDB-style files is described here.)

Timeline for d1b43b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b43b2