SCOPe 2.02: Domain d3m7wb_: 3m7w B:

Lineage for d3m7wb_ (3m7w B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (15 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [189300] (1 PDB entry)

8. Domain d3m7wb_: 3m7w B: [180922]
   automated match to d1gqna_
   complexed with dqa, gol

Details for d3m7wb_

PDB Entry: 3m7w, 1.95 Å

PDB Description: crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3m7wb_:

Sequence; same for both SEQRES and ATOM records:

>d3m7wb_ c.1.10.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
ktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesv
leaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgd
devkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadv
ltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisvad
lrtvltilhqa

Timeline for d3m7wb_:

• d3m7wb_ first appeared in SCOPe 2.01
  
• d3m7wb_ appears in SCOPe 2.03
  
• d3m7wb_ appears in the current release, SCOPe 2.08